PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010097641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 352aa    MW: 39083.6 Da    PI: 8.8808
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010097641.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.1e-32154207255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010097641.1 154 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 207
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15151208IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-28152208IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23154207IPR006447Myb domain, plants
PfamPF002492.3E-7155206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MFPTQNAIMR ATSSLPDLSL QISPPSLVLE NEAKEVVLSS RKPALLFNDR SSATDSGSST  60
SDLSHENGFY PSENKSISTT FGSSHVPTLS LGLEMVKDLI SSTAHPPVHH HHHPPRSFSN  120
STVSHFQHQP QIFRRDFKRN ARSISGVKRS VRAPRMRWTT TLHAHFVHAV QLLGGHERAT  180
PKSVLELMNV KDLTLAHVKS HLQMYRTVKS TDKAAGQGQT DMGLNQRPGI NLDDHVDGVL  240
SSEKFHLQSR VLPPNSHGGL WSSPSLDTAE RSNSSHENCS TFSRFQENVT KGDKQNSDIQ  300
VSDSLKERMD STSLSSNSNT CLNLEFTLGR PSWQKDHVHH DPSNNELNLL KC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2834723e-77KP283472.1 Prunus armeniaca aberrant testa shape (ATS) gene, complete cds.
GenBankKP2834733e-77KP283473.1 Prunus incisa isolate 462-2010A aberrant testa shape (ATS) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097641.10.0putative transcription factor KAN4
TrEMBLW9SP840.0W9SP84_9R
STRINGVIT_18s0001g11390.t017e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.14e-55G2-like family protein